Lineage for d4wsbc6 (4wsb C:1-247)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3021014Fold e.82: Influenza virus PB2 N-terminal region [418714] (1 superfamily)
    series of linked modules that wrap around one edge and face of PB1
  4. 3021015Superfamily e.82.1: Influenza virus PB2 N-terminal region [418744] (1 family) (S)
  5. 3021016Family e.82.1.1: Influenza virus PB2 N-terminal region [418796] (1 protein)
    Pfam PF02192
  6. 3021017Protein Polymerase basic protein 2, PB2 [419099] (2 species)
  7. 3021018Species Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [419607] (1 PDB entry)
  8. 3021019Domain d4wsbc6: 4wsb C:1-247 [414428]
    Other proteins in same PDB: d4wsba1, d4wsba2, d4wsba3, d4wsba4, d4wsbb_, d4wsbc1, d4wsbc2, d4wsbc3, d4wsbc4, d4wsbc5, d4wsbc7
    protein/RNA complex; complexed with po4, zn

Details for d4wsbc6

PDB Entry: 4wsb (more details), 2.65 Å

PDB Description: bat influenza a polymerase with bound vrna promoter
PDB Compounds: (C:) Polymerase PB2

SCOPe Domain Sequences for d4wsbc6:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsbc6 e.82.1.1 (C:1-247) Polymerase basic protein 2, PB2 {Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
merikelmemvknsrmreiltttsvdhmavikkytsgrqeknpalrmkwmmamkypisas
sriremipekdedgntlwtntkdagsnrvlvspnavtwwnragpvsdvvhyprvykmyfd
rlerlthgtfgpvkfynqvkvrkrvdinpghkdltsreaqevimevvfpnevgartlssd
aqltitkekkeelknckispimvaymlerelvrrtrflpiagatsstyvevlhltqgtcw
eqqytpg

SCOPe Domain Coordinates for d4wsbc6:

Click to download the PDB-style file with coordinates for d4wsbc6.
(The format of our PDB-style files is described here.)

Timeline for d4wsbc6:

  • d4wsbc6 is new in SCOPe 2.08-stable