Lineage for d4wsbc2 (4wsb C:539-684)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012258Fold d.396: Influenza virus PB2 '627' domain-like [418711] (1 superfamily)
    cluster of 6 helices wrapped by C-terminal beta sheet
  4. 3012259Superfamily d.396.1: Influenza virus PB2 '627' domain-like [418740] (2 families) (S)
  5. 3012260Family d.396.1.1: Influenza virus PB2 '627' domain [418792] (1 protein)
    Part of Pfam PF00604
  6. 3012261Protein Polymerase basic protein 2, PB2 [419095] (5 species)
  7. 3012267Species Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [419599] (1 PDB entry)
  8. 3012268Domain d4wsbc2: 4wsb C:539-684 [414424]
    Other proteins in same PDB: d4wsba1, d4wsba2, d4wsba3, d4wsba4, d4wsbb_, d4wsbc1, d4wsbc3, d4wsbc4, d4wsbc5, d4wsbc6, d4wsbc7
    protein/RNA complex; complexed with po4, zn

Details for d4wsbc2

PDB Entry: 4wsb (more details), 2.65 Å

PDB Description: bat influenza a polymerase with bound vrna promoter
PDB Compounds: (C:) Polymerase PB2

SCOPe Domain Sequences for d4wsbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsbc2 d.396.1.1 (C:539-684) Polymerase basic protein 2, PB2 {Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
vngpesiltntyhwiiknwellktqwmtdptvlynriefepfqtlipkgnraiysgftrt
lfqqmrdvegtfdsiqiikllpfsahppslgrtqfssftlnirgaplrllirgnsqvfny
nqmenviivlgksvgspersiltess

SCOPe Domain Coordinates for d4wsbc2:

Click to download the PDB-style file with coordinates for d4wsbc2.
(The format of our PDB-style files is described here.)

Timeline for d4wsbc2:

  • d4wsbc2 is new in SCOPe 2.08-stable