Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.396: Influenza virus PB2 '627' domain-like [418711] (1 superfamily) cluster of 6 helices wrapped by C-terminal beta sheet |
Superfamily d.396.1: Influenza virus PB2 '627' domain-like [418740] (2 families) |
Family d.396.1.1: Influenza virus PB2 '627' domain [418792] (1 protein) Part of Pfam PF00604 |
Protein Polymerase basic protein 2, PB2 [419095] (5 species) |
Species Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [419599] (1 PDB entry) |
Domain d4wsbc2: 4wsb C:539-684 [414424] Other proteins in same PDB: d4wsba1, d4wsba2, d4wsba3, d4wsba4, d4wsbb_, d4wsbc1, d4wsbc3, d4wsbc4, d4wsbc5, d4wsbc6, d4wsbc7 protein/RNA complex; complexed with po4, zn |
PDB Entry: 4wsb (more details), 2.65 Å
SCOPe Domain Sequences for d4wsbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsbc2 d.396.1.1 (C:539-684) Polymerase basic protein 2, PB2 {Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]} vngpesiltntyhwiiknwellktqwmtdptvlynriefepfqtlipkgnraiysgftrt lfqqmrdvegtfdsiqiikllpfsahppslgrtqfssftlnirgaplrllirgnsqvfny nqmenviivlgksvgspersiltess
Timeline for d4wsbc2: