Lineage for d4wsbc1 (4wsb C:685-741)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011561Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
    alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet
  4. 3011562Superfamily d.361.1: PB2 C-terminal domain-like [160453] (2 families) (S)
  5. 3011563Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
    C-terminal part of Pfam PF00604
  6. 3011564Protein Polymerase basic protein 2, PB2 [160455] (5 species)
  7. 3011570Species Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [419596] (1 PDB entry)
  8. 3011571Domain d4wsbc1: 4wsb C:685-741 [414423]
    Other proteins in same PDB: d4wsba1, d4wsba2, d4wsba3, d4wsba4, d4wsbb_, d4wsbc2, d4wsbc3, d4wsbc4, d4wsbc5, d4wsbc6, d4wsbc7
    protein/RNA complex; complexed with po4, zn

Details for d4wsbc1

PDB Entry: 4wsb (more details), 2.65 Å

PDB Description: bat influenza a polymerase with bound vrna promoter
PDB Compounds: (C:) Polymerase PB2

SCOPe Domain Sequences for d4wsbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsbc1 d.361.1.1 (C:685-741) Polymerase basic protein 2, PB2 {Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]}
siesavlrgflilgkanskygpvltigeldklgrgekanvligqgdtvlvmkrkrds

SCOPe Domain Coordinates for d4wsbc1:

Click to download the PDB-style file with coordinates for d4wsbc1.
(The format of our PDB-style files is described here.)

Timeline for d4wsbc1:

  • d4wsbc1 is new in SCOPe 2.08-stable