Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily) alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet |
Superfamily d.361.1: PB2 C-terminal domain-like [160453] (2 families) |
Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins) C-terminal part of Pfam PF00604 |
Protein Polymerase basic protein 2, PB2 [160455] (5 species) |
Species Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId:1129347] [419596] (1 PDB entry) |
Domain d4wsbc1: 4wsb C:685-741 [414423] Other proteins in same PDB: d4wsba1, d4wsba2, d4wsba3, d4wsba4, d4wsbb_, d4wsbc2, d4wsbc3, d4wsbc4, d4wsbc5, d4wsbc6, d4wsbc7 protein/RNA complex; complexed with po4, zn |
PDB Entry: 4wsb (more details), 2.65 Å
SCOPe Domain Sequences for d4wsbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsbc1 d.361.1.1 (C:685-741) Polymerase basic protein 2, PB2 {Influenza A virus (strain a/little yellow-shouldered bat/guatemala/060/2010(h17n10)) [TaxId: 1129347]} siesavlrgflilgkanskygpvltigeldklgrgekanvligqgdtvlvmkrkrds
Timeline for d4wsbc1: