SCOPe 2.08: Domain d4wq6a1: 4wq6 A:8-163

Lineage for d4wq6a1 (4wq6 A:8-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419805] (63 PDB entries)

8. Domain d4wq6a1: 4wq6 A:8-163 [414412]
   Other proteins in same PDB: d4wq6a2, d4wq6b2
   automated match to d2h3ba1
   complexed with 3tq, edo, po4

Details for d4wq6a1

PDB Entry: 4wq6, 1.72 Å

PDB Description: The crystal structure of human Nicotinamide phosphoribosyltransferase (NAMPT) in complex with N-(4-{(S)-[1-(2-methylpropyl)piperidin-4-yl]sulfinyl}benzyl)furo[2,3-c]pyridine-2-carboxamide inhibitor (compound 21)

PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d4wq6a1:

Sequence, based on SEQRES records:

>d4wq6a1 d.41.2.0 (A:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnillatdsykvthykqyppntskvysyfecrekktensklrkvkyeetvfyglqyiln
kylkgkvvtkekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfvipr
gnvlftventdpecywltnwietilvqswypitvat

Sequence, based on observed residues (ATOM records):

>d4wq6a1 d.41.2.0 (A:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnillatdsykvthykqyppntskvysyfecrekkyeetvfyglqyilnkylkgkvvtk
ekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprgnvlftvent
dpecywltnwietilvqswypitvat

Timeline for d4wq6a1:

• d4wq6a1 is new in SCOPe 2.08-stable