Lineage for d6gep_4 (6gep 426-570)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84106Fold d.134: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56013] (1 superfamily)
  4. 84107Superfamily d.134.1: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56014] (1 family) (S)
  5. 84108Family d.134.1.1: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56015] (1 protein)
  6. 84109Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)
  7. 84110Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)
  8. 84118Domain d6gep_4: 6gep 426-570 [41438]
    Other proteins in same PDB: d6gep_1, d6gep_2

Details for d6gep_4

PDB Entry: 6gep (more details), 1.8 Å

PDB Description: sulfite reductase hemoprotein nitric oxide complex reduced with proflavine edta

SCOP Domain Sequences for d6gep_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gep_4 d.134.1.1 (426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

SCOP Domain Coordinates for d6gep_4:

Click to download the PDB-style file with coordinates for d6gep_4.
(The format of our PDB-style files is described here.)

Timeline for d6gep_4: