Lineage for d6gepa3 (6gep A:149-345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977658Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)
  6. 2977707Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)
  7. 2977708Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)
  8. 2977715Domain d6gepa3: 6gep A:149-345 [41437]
    Other proteins in same PDB: d6gepa1, d6gepa2
    complexed with k, no, sf4, srm

Details for d6gepa3

PDB Entry: 6gep (more details), 1.8 Å

PDB Description: sulfite reductase hemoprotein nitric oxide complex reduced with proflavine edta
PDB Compounds: (A:) sulfite reductase hemoprotein

SCOPe Domain Sequences for d6gepa3:

Sequence, based on SEQRES records: (download)

>d6gepa3 d.134.1.1 (A:149-345) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]}
ndmnrnvlctsnpyesqlhaeayewakkisehllprtrayaeiwldqekvattdeepilg
qtylprkfkttvvippqndidlhandmnfvaiaengklvgfnllvggglsiehgnkktya
rtasefgylplehtlavaeavvttqrdwgnrtdrknaktkytlervgvetfkaeverrag
ikfepirpyeftgrgdr

Sequence, based on observed residues (ATOM records): (download)

>d6gepa3 d.134.1.1 (A:149-345) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]}
ndmnrnvlctsnpyesqlhaeayewakkisehllptylprkfkttvvippqndidlhand
mnfvaiaengklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvttqr
dwgnrtdrknaktkytlervgvetfkaeverragikfepirpyeftgrgdr

SCOPe Domain Coordinates for d6gepa3:

Click to download the PDB-style file with coordinates for d6gepa3.
(The format of our PDB-style files is described here.)

Timeline for d6gepa3: