Lineage for d3geo_4 (3geo 426-570)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36002Fold d.134: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56013] (1 superfamily)
  4. 36003Superfamily d.134.1: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56014] (1 family) (S)
  5. 36004Family d.134.1.1: Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56015] (1 protein)
  6. 36005Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)
  7. 36006Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)
  8. 36024Domain d3geo_4: 3geo 426-570 [41436]
    Other proteins in same PDB: d3geo_1, d3geo_2

Details for d3geo_4

PDB Entry: 3geo (more details), 2.1 Å

PDB Description: sulfite reductase hemoprotein nitrite complex

SCOP Domain Sequences for d3geo_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3geo_4 d.134.1.1 (426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

SCOP Domain Coordinates for d3geo_4:

Click to download the PDB-style file with coordinates for d3geo_4.
(The format of our PDB-style files is described here.)

Timeline for d3geo_4: