Lineage for d4uqvj_ (4uqv J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897388Species Methanocaldococcus jannaschii [TaxId:2190] [419893] (3 PDB entries)
  8. 2897398Domain d4uqvj_: 4uqv J: [414353]
    automated match to d6f93b_
    complexed with plp

Details for d4uqvj_

PDB Entry: 4uqv (more details), 3 Å

PDB Description: methanococcus jannaschii serine hydroxymethyl-transferase in complex with PLP
PDB Compounds: (J:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4uqvj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uqvj_ c.67.1.0 (J:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
meysdvpkfirdvsikqhewmresikliasenitslavreacatdfmhryaeglpgkrly
qgckyidevetlcielskelfkaehanvqptsgvvanlavffaetkpgdklmalsvpdgg
hishwkvsaagirglkvinhpfdpeemnidadamvkkileekpklilfggslfpfphpva
dayeaaqevgakiaydgahvlgliagkqfqdplregaeylmgsthktffgpqggvilttk
enadkidshvfpgvvsnhhlhhkaglaialaemlefgeayakqviknakalaqalyergf
nvlcehkdfteshqviidiesspdiefsaselakmyeeaniilnknllpwddvnnsdnps
girlgtqectrlgmkekemeeiaefmkriaidkekpekvredvkefakeystihysfdeg
dgfkylrfy

SCOPe Domain Coordinates for d4uqvj_:

Click to download the PDB-style file with coordinates for d4uqvj_.
(The format of our PDB-style files is described here.)

Timeline for d4uqvj_:

  • d4uqvj_ is new in SCOPe 2.08-stable