SCOP 1.75: Domain d5aopa4: 5aop A:426-570

Lineage for d5aopa4 (5aop A:426-570)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family)
   duplication: contains two domains of this fold

5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)

6. Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)

7. Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)

8. Domain d5aopa4: 5aop A:426-570 [41434]
   Other proteins in same PDB: d5aopa1, d5aopa2
   complexed with fs4, k, srm

Details for d5aopa4

PDB Entry: 5aop, 2.2 Å

PDB Description: sulfite reductase structure reduced with crii edta, 5-coordinate siroheme, siroheme feii, [4fe-4s] +1

PDB Compounds: (A:) sulfite reductase hemoprotein

SCOP Domain Sequences for d5aopa4:

Sequence; same for both SEQRES and ATOM records:

>d5aopa4 d.134.1.1 (A:426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

Timeline for d5aopa4:

• d5aopa4 first appeared (with stable ids) in SCOP 1.55, called d5aop_4
  
• d5aopa4 appears in SCOP 1.73
  
• d5aopa4 appears in SCOPe 2.01
  
• d5aopa4 appears in the current release, SCOPe 2.08