Lineage for d4tphb_ (4tph B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028261Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 3028262Superfamily f.38.1: MFS general substrate transporter [103473] (5 families) (S)
  5. 3028307Family f.38.1.0: automated matches [354001] (1 protein)
    not a true family
  6. 3028308Protein automated matches [354002] (3 species)
    not a true protein
  7. 3028311Species Shewanella oneidensis [TaxId:211586] [419932] (1 PDB entry)
  8. 3028313Domain d4tphb_: 4tph B: [414321]
    automated match to d6gs4a_
    complexed with ala, dby, lmt, zn

Details for d4tphb_

PDB Entry: 4tph (more details), 3.16 Å

PDB Description: selectivity mechanism of a bacterial homologue of the human drug peptide transporters pept1 and pept2
PDB Compounds: (B:) Proton:oligopeptide symporter POT family

SCOPe Domain Sequences for d4tphb_:

Sequence, based on SEQRES records: (download)

>d4tphb_ f.38.1.0 (B:) automated matches {Shewanella oneidensis [TaxId: 211586]}
vskthsfmtvslielwerfgyygmqalivyfmvqrlgfddsranlvwsacaaliyvspai
ggwvgdkilgtkrtmllgagilsvgyalmtvptentwfmfsalgvivvgnglfkpnagnl
vrkiyegddskidsaftiyymavnvgstfsmlltpwikdyvnaqygnefgwhaafavccv
gilvglgnyalmhkslanygsepdtrpvnkkslaivlalaalsvvasaiileyedvarvf
vyaagvavlgiffhlirtsepseragliaaliltvqtvfffifyqqmstslalfalrnvd
wdfqvfgthlwtwspaqfqalnpiwimvlspvlawsyswagrnnkdfsiaakfalgfavv
aigffiygfagqfavngktsswvmiwgyasyslgellvsglglamiaryvparmggfmmg
ayfvasgisqylggvvanfasvpqdlvdplqtlpvytnlfnklgvaavvctiialavlpl
mrrlt

Sequence, based on observed residues (ATOM records): (download)

>d4tphb_ f.38.1.0 (B:) automated matches {Shewanella oneidensis [TaxId: 211586]}
vskthsfmtvslielwerfgyygmqalivyfmvqrlgfddsranlvwsacaaliyvspai
ggwvgdkilgtkrtmllgagilsvgyalmtvptentwfmfsalgvivvgnglfkpnagnl
vrkiyeskidsaftiyymavnvgstfsmlltpwikdyvnaqygnefgwhaafavccvgil
vglgnyalmhkslanygsepdtrpvnkkslaivlalaalsvvasaiileyedvarvfvya
agvavlgiffhleragliaaliltvqtvfffifyqqmstslalfalrnvdwdfqvfgthl
wtwspaqfqalnpiwimvlspvlawiaakfalgfavvaigffiygfagqfavngktsswv
miwgyasyslgellvsglglamiarmmgayfvasgisqylggvvanfasvpqdlvdplqt
lpvytnlfnklgvaavvctiialavlplmrrlt

SCOPe Domain Coordinates for d4tphb_:

Click to download the PDB-style file with coordinates for d4tphb_.
(The format of our PDB-style files is described here.)

Timeline for d4tphb_:

  • d4tphb_ is new in SCOPe 2.08-stable