SCOPe 2.08: Domain d4rs4f2: 4rs4 F:192-346

Lineage for d4rs4f2 (4rs4 F:192-346)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Human coronavirus 229E [TaxId:11137] [419930] (2 PDB entries)

8. Domain d4rs4f2: 4rs4 F:192-346 [414294]
   Other proteins in same PDB: d4rs4a1, d4rs4a3, d4rs4b1, d4rs4b3, d4rs4c1, d4rs4c3, d4rs4d1, d4rs4d3, d4rs4e1, d4rs4e3, d4rs4f1, d4rs4f3
   automated match to d5yvda2
   mutant

Details for d4rs4f2

PDB Entry: 4rs4, 2.96 Å

PDB Description: crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229e

PDB Compounds: (F:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d4rs4f2:

Sequence; same for both SEQRES and ATOM records:

>d4rs4f2 d.294.1.0 (F:192-346) automated matches {Human coronavirus 229E [TaxId: 11137]}
dgfytqgrnlqdflprstmeedflnmdmgvfiqkygledfnfehvvygdvskttlgglhl
sisqvrlskmgilkaeefvaasditlkcctvtylndpssktvctymdlllddfvsvlksl
dltvvskvheviidnkpwrwmlwckdnavatfypq

Timeline for d4rs4f2:

• d4rs4f2 is new in SCOPe 2.08-stable