SCOPe 2.08: Domain d4rlza_: 4rlz A:

Lineage for d4rlza_ (4rlz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (51 species)
   not a true protein

7. Species Norovirus nlv/if1998/2003/iraq [TaxId:286545] [419926] (1 PDB entry)

8. Domain d4rlza_: 4rlz A: [414265]
   automated match to d5or7a_
   complexed with gol

Details for d4rlza_

PDB Entry: 4rlz, 1.19 Å

PDB Description: crystal structure of norovirus oif p domain

PDB Compounds: (A:) capsid protein

SCOPe Domain Sequences for d4rlza_:

Sequence; same for both SEQRES and ATOM records:

>d4rlza_ b.121.4.0 (A:) automated matches {Norovirus nlv/if1998/2003/iraq [TaxId: 286545]}
tkpftlpiltigeltnsrfpapidqlytspnadvvvqpqngrcsldgelqgttqllttai
csyrgmtsnptrdywdghllhlvhpngatydptedvpapfgtqdfrgilygvltqnpras
gdeaansqgvyisstsekftpklgtiglhqvqgniasnqqskftpvgiavngntpfrqwe
lpnysgaltlntnlapavgpnfpgeqilffrsnvpsvqggqpieidclipqewvshfyqe
sapsqsdvalvryvnpdtgrtifeaklhrqgfitiaatgsnpvvvppngyfrfdswvnqf
yalapm

Timeline for d4rlza_:

• d4rlza_ is new in SCOPe 2.08-stable