SCOPe 2.08: Domain d1aopa4: 1aop A:426-570

Lineage for d1aopa4 (1aop A:426-570)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families)
   duplication: contains two domains of this fold

5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)

6. Protein Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 [56016] (1 species)

7. Species Escherichia coli [TaxId:562] [56017] (12 PDB entries)

8. Domain d1aopa4: 1aop A:426-570 [41426]
   Other proteins in same PDB: d1aopa1, d1aopa2
   complexed with k, po4, sf4, srm

Details for d1aopa4

PDB Entry: 1aop, 1.6 Å

PDB Description: sulfite reductase structure at 1.6 angstrom resolution

PDB Compounds: (A:) sulfite reductase hemoprotein

SCOPe Domain Sequences for d1aopa4:

Sequence; same for both SEQRES and ATOM records:

>d1aopa4 d.134.1.1 (A:426-570) Sulfite reductase hemoprotein (SiRHP), domains 2 and 4 {Escherichia coli [TaxId: 562]}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

Timeline for d1aopa4:

• d1aopa4 first appeared (with stable ids) in SCOP 1.55, called d1aop_4
  
• d1aopa4 appears in SCOPe 2.07