Lineage for d1ffue2 (1ffu E:147-803)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262389Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 262390Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 262391Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 262397Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 262398Species Hydrogenophaga pseudoflava [TaxId:47421] [56012] (2 PDB entries)
  8. 262402Domain d1ffue2: 1ffu E:147-803 [41424]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffuc1, d1ffuc2, d1ffud1, d1ffud2, d1ffue1, d1ffuf1, d1ffuf2
    complexed with aro, cdp, csz, fad, fes

Details for d1ffue2

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
PDB Compounds: (E:)

SCOP Domain Sequences for d1ffue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffue2 d.133.1.1 (E:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvayrcs
frvteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkk
vldavdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceir
ihptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrs
tpvagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqa
yhqppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinp
miiegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsp
hhpigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

SCOP Domain Coordinates for d1ffue2:

Click to download the PDB-style file with coordinates for d1ffue2.
(The format of our PDB-style files is described here.)

Timeline for d1ffue2: