Lineage for d4r1fd2 (4r1f D:266-425)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931047Domain d4r1fd2: 4r1f D:266-425 [414229]
    Other proteins in same PDB: d4r1fa1, d4r1fb1, d4r1fc1, d4r1fd1
    automated match to d7l6sa2
    protein/DNA complex; complexed with adp, gol, mg, so4

Details for d4r1fd2

PDB Entry: 4r1f (more details), 2.51 Å

PDB Description: Re-refined Human DNA topoisomerase IIa (ATPase and transducer domains) in complex with ADP and SO4
PDB Compounds: (D:) DNA topoisomerase 2-alpha

SCOPe Domain Sequences for d4r1fd2:

Sequence, based on SEQRES records: (download)

>d4r1fd2 d.14.1.0 (D:266-425) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp
ksfgstcqlsekfikaaigcgivesilnwvkfkaqvqlnk

Sequence, based on observed residues (ATOM records): (download)

>d4r1fd2 d.14.1.0 (D:266-425) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkkviheqvnhrwevcltmsekgfqqisfvnsiatskggrhvdyvadqivt
klvdvvkkahqvknhmwifvnalienptfdsqtkenmtlqpksfgstcqlsekfikaaig
cgivwvkfkaqvqlnk

SCOPe Domain Coordinates for d4r1fd2:

Click to download the PDB-style file with coordinates for d4r1fd2.
(The format of our PDB-style files is described here.)

Timeline for d4r1fd2:

  • d4r1fd2 is new in SCOPe 2.08-stable