Lineage for d4r1fd1 (4r1f D:29-265)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974077Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries)
  8. 2974104Domain d4r1fd1: 4r1f D:29-265 [414228]
    Other proteins in same PDB: d4r1fa2, d4r1fb2, d4r1fc2, d4r1fd2
    automated match to d7l6sa1
    protein/DNA complex; complexed with adp, gol, mg, so4

Details for d4r1fd1

PDB Entry: 4r1f (more details), 2.51 Å

PDB Description: Re-refined Human DNA topoisomerase IIa (ATPase and transducer domains) in complex with ADP and SO4
PDB Compounds: (D:) DNA topoisomerase 2-alpha

SCOPe Domain Sequences for d4r1fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1fd1 d.122.1.0 (D:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

SCOPe Domain Coordinates for d4r1fd1:

Click to download the PDB-style file with coordinates for d4r1fd1.
(The format of our PDB-style files is described here.)

Timeline for d4r1fd1:

  • d4r1fd1 is new in SCOPe 2.08-stable