| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
| Protein automated matches [226867] (22 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries) |
| Domain d4r1fb1: 4r1f B:29-265 [414224] Other proteins in same PDB: d4r1fa2, d4r1fb2, d4r1fc2, d4r1fd2 automated match to d7l6sa1 protein/DNA complex; complexed with adp, gol, mg, so4 |
PDB Entry: 4r1f (more details), 2.51 Å
SCOPe Domain Sequences for d4r1fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r1fb1 d.122.1.0 (B:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk
Timeline for d4r1fb1: