SCOPe 2.08: Domain d4r1fa1: 4r1f A:29-265

Lineage for d4r1fa1 (4r1f A:29-265)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries)

8. Domain d4r1fa1: 4r1f A:29-265 [414222]
   Other proteins in same PDB: d4r1fa2, d4r1fb2, d4r1fc2, d4r1fd2
   automated match to d7l6sa1
   protein/DNA complex; complexed with adp, gol, mg, so4

Details for d4r1fa1

PDB Entry: 4r1f, 2.51 Å

PDB Description: Re-refined Human DNA topoisomerase IIa (ATPase and transducer domains) in complex with ADP and SO4

PDB Compounds: (A:) DNA topoisomerase 2-alpha

SCOPe Domain Sequences for d4r1fa1:

Sequence; same for both SEQRES and ATOM records:

>d4r1fa1 d.122.1.0 (A:29-265) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sveriyqkktqlehillrpdtyigsvelvtqqmwvydedvginyrevtfvpglykifdei
lvnaadnkqrdpkmscirvtidpennlisiwnngkgipvvehkvekmyvpalifgqllts
snydddekkvtggrngygaklcnifstkftvetasreykkmfkqtwmdnmgragemelkp
fngedytcitfqpdlskfkmqsldkdivalmvrraydiagstkdvkvflngnklpvk

Timeline for d4r1fa1:

• d4r1fa1 is new in SCOPe 2.08-stable