Lineage for d1ffve2 (1ffv E:147-803)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 protein domains)
  6. 2540533Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 2540534Species Hydrogenophaga pseudoflava [TaxId:47421] [56012] (2 PDB entries)
  8. 2540536Domain d1ffve2: 1ffv E:147-803 [41422]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb1, d1ffvc1, d1ffvc2, d1ffvd1, d1ffvd2, d1ffve1, d1ffvf1, d1ffvf2
    complexed with fad, fes, pcd

Details for d1ffve2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
PDB Compounds: (E:) cutl, molybdoprotein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffve2 d.133.1.1 (E:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava [TaxId: 47421]}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvayrcs
frvteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkk
vldavdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceir
ihptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrs
tpvagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqa
yhqppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinp
miiegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsp
hhpigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

SCOPe Domain Coordinates for d1ffve2:

Click to download the PDB-style file with coordinates for d1ffve2.
(The format of our PDB-style files is described here.)

Timeline for d1ffve2: