Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily) beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops |
Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) duplication: consists of 4 structural repeats arranged in 2 lobes contains one left-hand beta-alpha-beta unit per lobe |
Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (6 proteins) |
Protein Xanthine oxidase, C-terminal domain [56008] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [56009] (6 PDB entries) Uniprot P80457 |
Domain d1fiqc2: 1fiq C:695-1315 [41418] Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc1 complexed with fad, fes, gol, mos, mte, sal |
PDB Entry: 1fiq (more details), 2.5 Å
SCOPe Domain Sequences for d1fiqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fiqc2 d.133.1.1 (C:695-1315) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf rldspatpekirnacvdkftt
Timeline for d1fiqc2:
View in 3D Domains from other chains: (mouse over for more information) d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2 |