Lineage for d1fiqc2 (1fiq C:695-1315)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511393Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 511394Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 511395Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (5 proteins)
  6. 511433Protein Xanthine oxidase, C-terminal domain [56008] (1 species)
  7. 511434Species Cow (Bos taurus) [TaxId:9913] [56009] (4 PDB entries)
  8. 511439Domain d1fiqc2: 1fiq C:695-1315 [41418]
    Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc1

Details for d1fiqc2

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk
PDB Compounds: (C:)

SCOP Domain Sequences for d1fiqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqc2 d.133.1.1 (C:695-1315) Xanthine oxidase, C-terminal domain {Cow (Bos taurus)}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkftt

SCOP Domain Coordinates for d1fiqc2:

Click to download the PDB-style file with coordinates for d1fiqc2.
(The format of our PDB-style files is described here.)

Timeline for d1fiqc2: