Lineage for d1fiqc2 (1fiq C:695-1315)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137700Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 137701Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 137702Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 137727Protein Xanthine oxidase, C-terminal domain [56008] (1 species)
  7. 137728Species Cow (Bos taurus) [TaxId:9913] [56009] (2 PDB entries)
  8. 137731Domain d1fiqc2: 1fiq C:695-1315 [41418]
    Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc1

Details for d1fiqc2

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk

SCOP Domain Sequences for d1fiqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqc2 d.133.1.1 (C:695-1315) Xanthine oxidase, C-terminal domain {Cow (Bos taurus)}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkftt

SCOP Domain Coordinates for d1fiqc2:

Click to download the PDB-style file with coordinates for d1fiqc2.
(The format of our PDB-style files is described here.)

Timeline for d1fiqc2: