Lineage for d1dgja4 (1dgj A:311-906)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432242Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1432243Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1432244Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1432251Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 1432252Species Desulfovibrio desulfuricans [TaxId:876] [56007] (1 PDB entry)
  8. 1432253Domain d1dgja4: 1dgj A:311-906 [41415]
    Other proteins in same PDB: d1dgja1, d1dgja2, d1dgja3
    complexed with 2mo, fes, mcn

Details for d1dgja4

PDB Entry: 1dgj (more details), 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d1dgja4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgja4 d.133.1.1 (A:311-906) Aldehyde oxidoreductase {Desulfovibrio desulfuricans [TaxId: 876]}
msapeamapdaieihpgtpnvyydqleekgedtvpffndpanvvaegsyytqrqphlpie
pdvgygyineqgqvvihsksvaihlhalmiapglglefpkdlvlvqnttggtfgykfspt
mealvgvavmatgrpchlrynyeqqqnytgkrspfwttmryaadrqgkilametdwsvdh
gpysefgdlltlrgaqyigagygianirgtgrtvatnhcwgaafrgygapesefpsevlm
delaeklgmdpfelralncyregdttssgqipevmslpemfdkmrpyyeeskkrvkerst
aeikrgvgvalgvygagldgpdtseawvelnddgsvtlgnswedhgqgadagslgtahea
lrplgitpenihlvmndtsktpnsgpaggsrsqvvtgnairvacemliegmrkpgggfft
paemkaegrpmrydgkwtapakdcdakgqgspfacymyglfltevavevatgkatvekmv
cvadigkicnklvvdgqiygglaqgvglalsedyedlkkhstmggagipsikmipddiei
vyvetprkdgpfgasgvgempltaphaaiingiynacgarvrhlparpekvleamp

SCOPe Domain Coordinates for d1dgja4:

Click to download the PDB-style file with coordinates for d1dgja4.
(The format of our PDB-style files is described here.)

Timeline for d1dgja4: