Lineage for d1dgja4 (1dgj A:311-906)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35980Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 35981Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 35982Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (3 proteins)
  6. 35983Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 35984Species Desulfovibrio desulfuricans [TaxId:876] [56007] (1 PDB entry)
  8. 35985Domain d1dgja4: 1dgj A:311-906 [41415]
    Other proteins in same PDB: d1dgja1, d1dgja2, d1dgja3

Details for d1dgja4

PDB Entry: 1dgj (more details), 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:)

SCOP Domain Sequences for d1dgja4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgja4 d.133.1.1 (A:311-906) Aldehyde oxidoreductase {Desulfovibrio desulfuricans}
msapeamapdaieihpgtpnvyydqleekgedtvpffndpanvvaegsyytqrqphlpie
pdvgygyineqgqvvihsksvaihlhalmiapglglefpkdlvlvqnttggtfgykfspt
mealvgvavmatgrpchlrynyeqqqnytgkrspfwttmryaadrqgkilametdwsvdh
gpysefgdlltlrgaqyigagygianirgtgrtvatnhcwgaafrgygapesefpsevlm
delaeklgmdpfelralncyregdttssgqipevmslpemfdkmrpyyeeskkrvkerst
aeikrgvgvalgvygagldgpdtseawvelnddgsvtlgnswedhgqgadagslgtahea
lrplgitpenihlvmndtsktpnsgpaggsrsqvvtgnairvacemliegmrkpgggfft
paemkaegrpmrydgkwtapakdcdakgqgspfacymyglfltevavevatgkatvekmv
cvadigkicnklvvdgqiygglaqgvglalsedyedlkkhstmggagipsikmipddiei
vyvetprkdgpfgasgvgempltaphaaiingiynacgarvrhlparpekvleamp

SCOP Domain Coordinates for d1dgja4:

Click to download the PDB-style file with coordinates for d1dgja4.
(The format of our PDB-style files is described here.)

Timeline for d1dgja4: