Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus hu/gi.7/tch-060/usa/2003 [TaxId:1097017] [419920] (6 PDB entries) |
Domain d4p2na_: 4p2n A: [414135] automated match to d5or7a_ |
PDB Entry: 4p2n (more details), 1.7 Å
SCOPe Domain Sequences for d4p2na_:
Sequence, based on SEQRES records: (download)
>d4p2na_ b.121.4.0 (A:) automated matches {Norovirus hu/gi.7/tch-060/usa/2003 [TaxId: 1097017]} qltvpniplnnlansrvpaminkmtvstdqnqvvqfqngrctlegqllgttpvsasqvar irgkvfstasgkglnlteldgtpyhafespaplgfpdigacdwhvstfkvdqnlsgdpms rldvkqnapfaphlgsieftsdqdptgdqlgtlawvspstsgarvdpwkipsygstvtes thlappifppgfgeaivyfmsdfpivsgntaqvpctlpqefvshfveqqapvrgeaallh yvdpdthrnlgefklypdgfitcvpntgggpqnlptngvfvfsswvsryyqlkpv
>d4p2na_ b.121.4.0 (A:) automated matches {Norovirus hu/gi.7/tch-060/usa/2003 [TaxId: 1097017]} qltvpniplnnlansrvpaminkmtvstdqnqvvqfqngrctlegqllgttpvsasqvar irgkvfstasgkglnlteldgtpyhaspaplgfpdigacdwhvstfkvdqnlsgdpmsrl dvkqnapfaphlgsieftsdqdptgdqlgtlawvspstsgarvdpwkipsyhlappifpp gfgeaivyfmsdfpivsgntaqvpctlpqefvshfveqqapvrgeaallhyvdpdthrnl gefklypdgfitcvpntgggpqnlptngvfvfsswvsryyqlkpv
Timeline for d4p2na_: