Lineage for d4opob1 (4opo B:225-530)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822803Species Norovirus hu/gii-4/kumamoto5/2006/jp [TaxId:546987] [419917] (2 PDB entries)
  8. 2822806Domain d4opob1: 4opo B:225-530 [414093]
    Other proteins in same PDB: d4opoa2, d4opob2
    automated match to d5or7a_
    complexed with act, edo

Details for d4opob1

PDB Entry: 4opo (more details), 1.4 Å

PDB Description: crystal structure of p domain from norovirus strain saga4 in complex with hbga type leb (tetraglycan)
PDB Compounds: (B:) vp1

SCOPe Domain Sequences for d4opob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4opob1 b.121.4.0 (B:225-530) automated matches {Norovirus hu/gii-4/kumamoto5/2006/jp [TaxId: 546987]}
kpftvpiltveemtnsrfpipleklftgpsgafvvqpqngrcttdgvllgttqlspvnic
tfrgdvthiagsrnytmnlaslnwnnydpteeipaplgtpdfvgkiqglltqttkgdgst
rghkatvytgsapftpklgsvqfstdtendfethqntkftpvgviqdgstthrnepqqwv
lpsysgrnvhnvhlapavaptfpgeqllffrstmpgcsgypnmdldcllpqewvqhfyqe
aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf
ytlapm

SCOPe Domain Coordinates for d4opob1:

Click to download the PDB-style file with coordinates for d4opob1.
(The format of our PDB-style files is described here.)

Timeline for d4opob1:

  • d4opob1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4opob2