SCOPe 2.08: Domain d4opob1: 4opo B:225-530

Lineage for d4opob1 (4opo B:225-530)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (51 species)
   not a true protein

7. Species Norovirus hu/gii-4/kumamoto5/2006/jp [TaxId:546987] [419917] (2 PDB entries)

8. Domain d4opob1: 4opo B:225-530 [414093]
   Other proteins in same PDB: d4opoa2, d4opob2
   automated match to d5or7a_
   complexed with act, edo

Details for d4opob1

PDB Entry: 4opo, 1.4 Å

PDB Description: crystal structure of p domain from norovirus strain saga4 in complex with hbga type leb (tetraglycan)

PDB Compounds: (B:) vp1

SCOPe Domain Sequences for d4opob1:

Sequence; same for both SEQRES and ATOM records:

>d4opob1 b.121.4.0 (B:225-530) automated matches {Norovirus hu/gii-4/kumamoto5/2006/jp [TaxId: 546987]}
kpftvpiltveemtnsrfpipleklftgpsgafvvqpqngrcttdgvllgttqlspvnic
tfrgdvthiagsrnytmnlaslnwnnydpteeipaplgtpdfvgkiqglltqttkgdgst
rghkatvytgsapftpklgsvqfstdtendfethqntkftpvgviqdgstthrnepqqwv
lpsysgrnvhnvhlapavaptfpgeqllffrstmpgcsgypnmdldcllpqewvqhfyqe
aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf
ytlapm

Timeline for d4opob1:

• d4opob1 is new in SCOPe 2.08-stable