SCOPe 2.08: Domain d4o1ca1: 4o1c A:8-163

Lineage for d4o1ca1 (4o1c A:8-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419805] (63 PDB entries)

8. Domain d4o1ca1: 4o1c A:8-163 [414056]
   Other proteins in same PDB: d4o1ca2, d4o1cb2
   automated match to d2h3ba1
   complexed with edo, po4; mutant

Details for d4o1ca1

PDB Entry: 4o1c, 2.09 Å

PDB Description: The crystal structures of a mutant NAMPT H191R

PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d4o1ca1:

Sequence, based on SEQRES records:

>d4o1ca1 d.41.2.0 (A:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnillatdsykvthykqyppntskvysyfecrekktensklrkvkyeetvfyglqyiln
kylkgkvvtkekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfvipr
gnvlftventdpecywltnwietilvqswypitvat

Sequence, based on observed residues (ATOM records):

>d4o1ca1 d.41.2.0 (A:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnillatdsykvthykqyppntskvysyfecrekkkyeetvfyglqyilnkylkgkvvt
kekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprgnvlftven
tdpecywltnwietilvqswypitvat

Timeline for d4o1ca1:

• d4o1ca1 is new in SCOPe 2.08-stable