Lineage for d1axce2 (1axc E:127-255)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334427Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 334428Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 334447Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
    duplication: consists of two domains of this fold
  6. 334469Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species)
  7. 334486Species Human (Homo sapiens) [TaxId:9606] [55991] (1 PDB entry)
  8. 334492Domain d1axce2: 1axc E:127-255 [41397]

Details for d1axce2

PDB Entry: 1axc (more details), 2.6 Å

PDB Description: human pcna

SCOP Domain Sequences for d1axce2:

Sequence, based on SEQRES records: (download)

>d1axce2 d.131.1.2 (E:127-255) Prolifirating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

Sequence, based on observed residues (ATOM records): (download)

>d1axce2 d.131.1.2 (E:127-255) Prolifirating cell nuclear antigen (PCNA) {Human (Homo sapiens)}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nveeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlk
yylapki

SCOP Domain Coordinates for d1axce2:

Click to download the PDB-style file with coordinates for d1axce2.
(The format of our PDB-style files is described here.)

Timeline for d1axce2: