Lineage for d4lvdb1 (4lvd B:8-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944970Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) (S)
  5. 2945049Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2945050Protein automated matches [226878] (11 species)
    not a true protein
  7. 2945066Species Human (Homo sapiens) [TaxId:9606] [419805] (63 PDB entries)
  8. 2945141Domain d4lvdb1: 4lvd B:8-163 [413945]
    Other proteins in same PDB: d4lvda2, d4lvdb2
    automated match to d2h3ba1
    complexed with 1eb, edo, po4

Details for d4lvdb1

PDB Entry: 4lvd (more details), 1.75 Å

PDB Description: fragment-based identification of amides derived from trans-2-(pyridin- 3-yl)cyclopropanecarboxylic acid as potent inhibitors of human nicotinamide phosphoribosyltransferase (nampt)
PDB Compounds: (B:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d4lvdb1:

Sequence, based on SEQRES records: (download)

>d4lvdb1 d.41.2.0 (B:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnillatdsykvthykqyppntskvysyfecrekktensklrkvkyeetvfyglqyiln
kylkgkvvtkekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfvipr
gnvlftventdpecywltnwietilvqswypitvat

Sequence, based on observed residues (ATOM records): (download)

>d4lvdb1 d.41.2.0 (B:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnillatdsykvthykqyppntskvysyfecrekkyeetvfyglqyilnkylkgkvvtk
ekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprgnvlftvent
dpecywltnwietilvqswypitvat

SCOPe Domain Coordinates for d4lvdb1:

Click to download the PDB-style file with coordinates for d4lvdb1.
(The format of our PDB-style files is described here.)

Timeline for d4lvdb1:

  • d4lvdb1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4lvdb2