Lineage for d4lvda2 (4lvd A:164-486)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839666Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
    automatically mapped to Pfam PF04095
  6. 2839691Protein automated matches [419237] (3 species)
    not a true protein
  7. 2839692Species Human (Homo sapiens) [TaxId:9606] [419806] (63 PDB entries)
  8. 2839766Domain d4lvda2: 4lvd A:164-486 [413944]
    Other proteins in same PDB: d4lvda1, d4lvdb1
    automated match to d2h3ba2
    complexed with 1eb, edo, po4

Details for d4lvda2

PDB Entry: 4lvd (more details), 1.75 Å

PDB Description: fragment-based identification of amides derived from trans-2-(pyridin- 3-yl)cyclopropanecarboxylic acid as potent inhibitors of human nicotinamide phosphoribosyltransferase (nampt)
PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d4lvda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lvda2 c.1.17.2 (A:164-486) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsreqkkilakylletsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
lalikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrstqapliirpdsgnpldtvlkvleilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkmwsieniafgsgggllqkltrdllncsfkcsy
vvtnglginvfkdpvadpnkrskkgrlslhrtpagnfvtleegkgdleeygqdllhtvfk
ngkvtksysfdeirknaqlniel

SCOPe Domain Coordinates for d4lvda2:

Click to download the PDB-style file with coordinates for d4lvda2.
(The format of our PDB-style files is described here.)

Timeline for d4lvda2:

  • d4lvda2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4lvda1