SCOPe 2.08: Domain d4lvaa2: 4lva A:164-486

Lineage for d4lvaa2 (4lva A:164-486)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
   automatically mapped to Pfam PF04095

6. Protein automated matches [419237] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [419806] (63 PDB entries)

8. Domain d4lvaa2: 4lva A:164-486 [413936]
   Other proteins in same PDB: d4lvaa1, d4lvab1
   automated match to d2h3ba2
   complexed with 20m, edo, po4

Details for d4lvaa2

PDB Entry: 4lva, 1.55 Å

PDB Description: fragment-based identification of amides derived from trans-2-(pyridin- 3-yl)cyclopropanecarboxylic acid as potent inhibitors of human nicotinamide phosphoribosyltransferase (nampt)

PDB Compounds: (A:) Nicotinamide phosphoribosyltransferase

SCOPe Domain Sequences for d4lvaa2:

Sequence; same for both SEQRES and ATOM records:

>d4lvaa2 c.1.17.2 (A:164-486) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsreqkkilakylletsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvag
lalikkyygtkdpvpgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydi
ynacekiwgedlrhlivsrstqapliirpdsgnpldtvlkvleilgkkfpvtenskgykl
lppylrviqgdgvdintlqeivegmkqkmwsieniafgsgggllqkltrdllncsfkcsy
vvtnglginvfkdpvadpnkrskkgrlslhrtpagnfvtleegkgdleeygqdllhtvfk
ngkvtksysfdeirknaqlniel

Timeline for d4lvaa2:

• d4lvaa2 is new in SCOPe 2.08-stable