![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (158 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [272710] (21 PDB entries) |
![]() | Domain d4lj7a_: 4lj7 A: [413917] automated match to d6oaxa1 complexed with mnt, po4 |
PDB Entry: 4lj7 (more details), 2.8 Å
SCOPe Domain Sequences for d4lj7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lj7a_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} erekllrleeelhkrvvgqdeairavadairraraglkdpnrpigsflflgptgvgqtel aktlaatlfdteeamiridmteymekhavsrligappgyvgyeeggqlteavrrrpysvi lfdeiekahpdvfnillqilddgrltdshgrtvdfrntviiltsnlgsplileglqkgwp yerirdevfkvlqqhfrpeflnrldeivvfrpltkeqirqiveiqlsylrarlaekrisl elteaakdflaergydpvfgarplrrviqreletplaqkilagevkegdrvqvdvgpagl vfavp
Timeline for d4lj7a_: