Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) |
Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
Protein automated matches [226878] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [419805] (63 PDB entries) |
Domain d4l4mb1: 4l4m B:8-163 [413909] Other proteins in same PDB: d4l4ma2, d4l4mb2 automated match to d2h3ba1 complexed with 1xd, edo, po4 |
PDB Entry: 4l4m (more details), 2.44 Å
SCOPe Domain Sequences for d4l4mb1:
Sequence, based on SEQRES records: (download)
>d4l4mb1 d.41.2.0 (B:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]} efnillatdsykvthykqyppntskvysyfecrekktensklrkvkyeetvfyglqyiln kylkgkvvtkekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfvipr gnvlftventdpecywltnwietilvqswypitvat
>d4l4mb1 d.41.2.0 (B:8-163) automated matches {Human (Homo sapiens) [TaxId: 9606]} efnillatdsykvthykqyppntskvysyfecrekvkyeetvfyglqyilnkylkgkvvt kekiqeakdvykehfqddvfnekgwnyilekydghlpieikavpegfviprgnvlftven tdpecywltnwietilvqswypitvat
Timeline for d4l4mb1: