SCOP 1.69: Domain d1plr_1: 1plr 1-126

Lineage for d1plr_1 (1plr 1-126)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (3 PDB entries)

8. Domain d1plr_1: 1plr 1-126 [41390]

Details for d1plr_1

PDB Entry: 1plr, 3 Å

PDB Description: crystal structure of the eukaryotic dna polymerase processivity factor pcna

SCOP Domain Sequences for d1plr_1:

Sequence; same for both SEQRES and ATOM records:

>d1plr_1 d.131.1.2 (1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae)}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

Timeline for d1plr_1:

• d1plr_1 first appeared (with stable ids) in SCOP 1.55
  
• d1plr_1 appears in SCOP 1.67
  
• d1plr_1 appears in SCOP 1.71
  
• d1plr_1 appears in the current release, SCOPe 2.08, called d1plra1