| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) duplication: consists of two domains of this fold |
| Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (2 PDB entries) |
| Domain d1plr_1: 1plr 1-126 [41390] |
PDB Entry: 1plr (more details), 3 Å
SCOP Domain Sequences for d1plr_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1plr_1 d.131.1.2 (1-126) Prolifirating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae)}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl
Timeline for d1plr_1: