Lineage for d1plq_2 (1plq 127-258)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511273Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 511274Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 511311Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 511333Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 511361Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (3 PDB entries)
  8. 511363Domain d1plq_2: 1plq 127-258 [41389]
    CASP1

Details for d1plq_2

PDB Entry: 1plq (more details), 2.3 Å

PDB Description: crystal structure of the eukaryotic dna polymerase processivity factor pcna

SCOP Domain Sequences for d1plq_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plq_2 d.131.1.2 (127-258) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae)}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfndee

SCOP Domain Coordinates for d1plq_2:

Click to download the PDB-style file with coordinates for d1plq_2.
(The format of our PDB-style files is described here.)

Timeline for d1plq_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plq_1