Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.24: L,D-transpeptidase immunoglobulin-like domain [418802] (1 protein) Pfam PF17964 |
Protein L,D-transpeptidase immunoglobulin-like domain [419105] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [419618] (6 PDB entries) |
Domain d4huca1: 4huc A:149-251 [413831] Other proteins in same PDB: d4huca2, d4huca3, d4hucb2 automated match to d3tura1 complexed with act, na |
PDB Entry: 4huc (more details), 1.86 Å
SCOPe Domain Sequences for d4huca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huca1 b.1.18.24 (A:149-251) L,D-transpeptidase immunoglobulin-like domain {Mycobacterium tuberculosis [TaxId: 1773]} ahltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegafywlnnrev rwrpehfwkpgtavdvavntygvdlgegmfgednvqthftigd
Timeline for d4huca1: