Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein UL42 [55987] (1 species) |
Species Human herpesvirus type 1 [TaxId:10298] [55988] (1 PDB entry) |
Domain d1dmlc2: 1dml C:170-319 [41383] protein/DNA complex |
PDB Entry: 1dml (more details), 2.7 Å
SCOPe Domain Sequences for d1dmlc2:
Sequence, based on SEQRES records: (download)
>d1dmlc2 d.131.1.2 (C:170-319) UL42 {Human herpesvirus type 1 [TaxId: 10298]} pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvs sststqvqilsnaltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlk fflttpvpslcvtatgpnavsavfllkpqk
>d1dmlc2 d.131.1.2 (C:170-319) UL42 {Human herpesvirus type 1 [TaxId: 10298]} pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareeggq aaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslcvtatgpna vsavfllkpqk
Timeline for d1dmlc2: