Lineage for d1dmlc2 (1dml C:170-319)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583709Protein UL42 [55987] (1 species)
  7. 2583710Species Human herpesvirus type 1 [TaxId:10298] [55988] (1 PDB entry)
  8. 2583714Domain d1dmlc2: 1dml C:170-319 [41383]
    protein/DNA complex

Details for d1dmlc2

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol
PDB Compounds: (C:) DNA polymerase processivity factor

SCOPe Domain Sequences for d1dmlc2:

Sequence, based on SEQRES records: (download)

>d1dmlc2 d.131.1.2 (C:170-319) UL42 {Human herpesvirus type 1 [TaxId: 10298]}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvs
sststqvqilsnaltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlk
fflttpvpslcvtatgpnavsavfllkpqk

Sequence, based on observed residues (ATOM records): (download)

>d1dmlc2 d.131.1.2 (C:170-319) UL42 {Human herpesvirus type 1 [TaxId: 10298]}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareeggq
aaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslcvtatgpna
vsavfllkpqk

SCOPe Domain Coordinates for d1dmlc2:

Click to download the PDB-style file with coordinates for d1dmlc2.
(The format of our PDB-style files is described here.)

Timeline for d1dmlc2: