Lineage for d1dmlc2 (1dml C:170-319)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84022Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 84023Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 84036Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
  6. 84074Protein UL42 [55987] (1 species)
  7. 84075Species Human herpes virus type 1 [55988] (1 PDB entry)
  8. 84079Domain d1dmlc2: 1dml C:170-319 [41383]

Details for d1dmlc2

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

SCOP Domain Sequences for d1dmlc2:

Sequence, based on SEQRES records: (download)

>d1dmlc2 d.131.1.2 (C:170-319) UL42 {Human herpes virus type 1}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareegvs
sststqvqilsnaltkagqaaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlk
fflttpvpslcvtatgpnavsavfllkpqk

Sequence, based on observed residues (ATOM records): (download)

>d1dmlc2 d.131.1.2 (C:170-319) UL42 {Human herpes virus type 1}
pqgtpdvqlrltrpqltkvlnatgadsatpttfelgvngkfsvfttstcvtfaareeggq
aaanaktvygenthrtfsvvvddcsmravlrrlqvgggtlkfflttpvpslcvtatgpna
vsavfllkpqk

SCOP Domain Coordinates for d1dmlc2:

Click to download the PDB-style file with coordinates for d1dmlc2.
(The format of our PDB-style files is described here.)

Timeline for d1dmlc2: