SCOPe 2.08: Domain d4gsua2: 4gsu A:252-408

Lineage for d4gsua2 (4gsu A:252-408)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family)
   automatically mapped to Pfam PF03734

5. Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
   Pfam PF03734; ErfK/YbiS/YcfS/YnhG

6. Protein automated matches [234004] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [419883] (5 PDB entries)

8. Domain d4gsua2: 4gsu A:252-408 [413806]
   Other proteins in same PDB: d4gsua1, d4gsub1
   automated match to d3tura2
   complexed with dwz

Details for d4gsua2

PDB Entry: 4gsu, 2 Å

PDB Description: structural basis for the inhibition of mycobacterium tuberculosis l,d- transpeptidase by meropenem, a drug effective against extensively drug-resistant strains

PDB Compounds: (A:) probable conserved lipoprotein lpps

SCOPe Domain Sequences for d4gsua2:

Sequence; same for both SEQRES and ATOM records:

>d4gsua2 b.160.1.1 (A:252-408) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
eviataddntkiltvrvngevvksmptsmgkdstptangiyivgsrykhiimdsstygvp
vnspngyrtdvdwatqisysgvfvhsapwsvgaqghtntshgclnvspsnaqwfydhvkr
gdivevvntvggtlpgidglgdwnipwdqwragnaka

Timeline for d4gsua2:

• d4gsua2 is new in SCOPe 2.08-stable