SCOP 1.71: Domain d1dmla1: 1dml A:29-169

Lineage for d1dmla1 (1dml A:29-169)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetry
Superfamily d.131.1: DNA clamp [55979] (2 families)
Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
duplication: consists of two domains of this fold
Protein UL42 [55987] (1 species)
Species Human herpes virus type 1 [55988] (1 PDB entry)
Domain d1dmla1: 1dml A:29-169 [41380]

Details for d1dmla1

PDB Entry: 1dml (more details), 2.7 Å

PDB Description: crystal structure of herpes simplex ul42 bound to the c-terminus of hsv pol

SCOP Domain Sequences for d1dmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dmla1 d.131.1.2 (A:29-169) UL42 {Human herpes virus type 1}
apcqvvlqgaelngilqafaplrtslldsllvmgdrgilihntifgeqvflplehsqfsr
yrwrgptaaflslvdqkrsllsvfranqypdlrrvelaitgqapfrtlvqriwtttsdge
avelasetlmkreltsfvvlv

SCOP Domain Coordinates for d1dmla1:

Click to download the PDB-style file with coordinates for d1dmla1.
(The format of our PDB-style files is described here.)

Timeline for d1dmla1: