Lineage for d4g26a2 (4g26 A:300-352,A:535-570)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039217Fold g.103: Protein-only RNAse P central domain-like [418734] (1 superfamily)
    core: 4-stranded antiparallel beta sheet that coordinates zinc, order 1432
  4. 3039218Superfamily g.103.1: Protein-only RNAse P central domain-like [418780] (1 family) (S)
  5. 3039219Family g.103.1.1: Protein-only RNAse P central domain-like [418870] (1 protein)
  6. 3039220Protein Proteinaceous RNAse P1 (PRORP1) [419227] (1 species)
  7. 3039221Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419752] (8 PDB entries)
  8. 3039222Domain d4g26a2: 4g26 A:300-352,A:535-570 [413790]
    Other proteins in same PDB: d4g26a1, d4g26a3
    automated match to d4g25a3
    complexed with ca, zn

Details for d4g26a2

PDB Entry: 4g26 (more details), 1.75 Å

PDB Description: Crystal Structure of proteinaceous RNase P 1 (PRORP1) from A. thaliana with Ca
PDB Compounds: (A:) Pentatricopeptide repeat-containing protein At2g32230, mitochondrial

SCOPe Domain Sequences for d4g26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g26a2 g.103.1.1 (A:300-352,A:535-570) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvkkwdvkkirdavvsggggwhgqgwlgtgkwnvkrtemdengvckcckeklvXysiviq
esedgtwhvpmsveddlqtsrqwlcakrsk

SCOPe Domain Coordinates for d4g26a2:

Click to download the PDB-style file with coordinates for d4g26a2.
(The format of our PDB-style files is described here.)

Timeline for d4g26a2:

  • d4g26a2 is new in SCOPe 2.08-stable