SCOP 1.67: Domain d1czdc2: 1czd C:3111-3228

Lineage for d1czdc2 (1czd C:3111-3228)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (2 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
   duplication: consists of two domains of this fold

6. Protein gp45 sliding clamp [55984] (2 species)

7. Species Bacteriophage T4 [TaxId:10665] [55986] (1 PDB entry)

8. Domain d1czdc2: 1czd C:3111-3228 [41379]

Details for d1czdc2

PDB Entry: 1czd, 2.45 Å

PDB Description: crystal structure of the processivity clamp gp45 from bacteriophage t4

SCOP Domain Sequences for d1czdc2:

Sequence; same for both SEQRES and ATOM records:

>d1czdc2 d.131.1.2 (C:3111-3228) gp45 sliding clamp {Bacteriophage T4}
vasavteikaedlqqllrvsrglqidtiaitvkegkivingfnkvedsaltrvkysltlg
dydgentfnfiinmanmkmqpgnyklllwakgkqgaakfegehanyvvaleadsthdf

Timeline for d1czdc2:

• d1czdc2 first appeared (with stable ids) in SCOP 1.55
  
• d1czdc2 appears in SCOP 1.65
  
• d1czdc2 appears in SCOP 1.69
  
• d1czdc2 appears in the current release, SCOPe 2.08