![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.10: Pentatricopeptide repeat (PPR) [418869] (1 protein) Pfam PF17177 |
![]() | Protein Proteinaceous RNAse P1 (PRORP1) [419226] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419751] (8 PDB entries) |
![]() | Domain d4g26a1: 4g26 A:95-299 [413789] Other proteins in same PDB: d4g26a2, d4g26a3 automated match to d4g25a1 complexed with ca, zn |
PDB Entry: 4g26 (more details), 1.75 Å
SCOPe Domain Sequences for d4g26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g26a1 a.118.8.10 (A:95-299) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} speallkqkldmcskkgdvlealrlydearrngvqlsqyhynvllyvcslaeaatesspn pglsrgfdifkqmivdkvvpneatftngarlavakddpemafdmvkqmkafgiqprlrsy gpalfgfcrkgdadkayevdahmvesevvpeepelaallkvsmdtknadkvyktlqrlrd lvrqvskstfdmieewfksevatkt
Timeline for d4g26a1: