Lineage for d4g26a1 (4g26 A:95-299)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726978Family a.118.8.10: Pentatricopeptide repeat (PPR) [418869] (1 protein)
    Pfam PF17177
  6. 2726979Protein Proteinaceous RNAse P1 (PRORP1) [419226] (1 species)
  7. 2726980Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419751] (8 PDB entries)
  8. 2726981Domain d4g26a1: 4g26 A:95-299 [413789]
    Other proteins in same PDB: d4g26a2, d4g26a3
    automated match to d4g25a1
    complexed with ca, zn

Details for d4g26a1

PDB Entry: 4g26 (more details), 1.75 Å

PDB Description: Crystal Structure of proteinaceous RNase P 1 (PRORP1) from A. thaliana with Ca
PDB Compounds: (A:) Pentatricopeptide repeat-containing protein At2g32230, mitochondrial

SCOPe Domain Sequences for d4g26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g26a1 a.118.8.10 (A:95-299) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
speallkqkldmcskkgdvlealrlydearrngvqlsqyhynvllyvcslaeaatesspn
pglsrgfdifkqmivdkvvpneatftngarlavakddpemafdmvkqmkafgiqprlrsy
gpalfgfcrkgdadkayevdahmvesevvpeepelaallkvsmdtknadkvyktlqrlrd
lvrqvskstfdmieewfksevatkt

SCOPe Domain Coordinates for d4g26a1:

Click to download the PDB-style file with coordinates for d4g26a1.
(The format of our PDB-style files is described here.)

Timeline for d4g26a1:

  • d4g26a1 is new in SCOPe 2.08-stable