![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
![]() | Family c.120.1.3: Protein-only RNAse P nuclease domain-like [418871] (1 protein) Pfam PF16953 Homology to Nedd4-BP1, YacP nuclease (NYN) and PIN discussed in PubMed 17114934 |
![]() | Protein Proteinaceous RNAse P1 (PRORP1) [419228] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419753] (8 PDB entries) |
![]() | Domain d4g25a2: 4g25 A:353-534 [413787] Other proteins in same PDB: d4g25a1, d4g25a3 complexed with sr, zn |
PDB Entry: 4g25 (more details), 2 Å
SCOPe Domain Sequences for d4g25a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g25a2 c.120.1.3 (A:353-534) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} cidinpvetetfaasltrlacerevkanfnqfqewlerhgpfdavidganmglvnqrsfs ffqlnntvqrcqqispskrlplvilhksrvnggpatypknrallekwknagalyatppgs nddwywlyaavsckcllvtndemrdhlfqllgnsffprwkekhqvrisvtredglklnmp pp
Timeline for d4g25a2: