Lineage for d4g23a3 (4g23 A:353-534)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921967Family c.120.1.3: Protein-only RNAse P nuclease domain-like [418871] (1 protein)
    Pfam PF16953
    Homology to Nedd4-BP1, YacP nuclease (NYN) and PIN discussed in PubMed 17114934
  6. 2921968Protein Proteinaceous RNAse P1 (PRORP1) [419228] (1 species)
  7. 2921969Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [419753] (8 PDB entries)
  8. 2921971Domain d4g23a3: 4g23 A:353-534 [413782]
    Other proteins in same PDB: d4g23a1, d4g23a2
    automated match to d4g25a2
    complexed with zn

Details for d4g23a3

PDB Entry: 4g23 (more details), 1.98 Å

PDB Description: Crystal Structure of proteinaceous RNase P 1 (PRORP1) from A. thaliana with Mn
PDB Compounds: (A:) Pentatricopeptide repeat-containing protein At2g32230, mitochondrial

SCOPe Domain Sequences for d4g23a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g23a3 c.120.1.3 (A:353-534) Proteinaceous RNAse P1 (PRORP1) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
cidinpvetetfaasltrlacerevkanfnqfqewlerhgpfdavidganmglvnqrsfs
ffqlnntvqrcqqispskrlplvilhksrvnggpatypknrallekwknagalyatppgs
nddwywlyaavsckcllvtndemrdhlfqllgnsffprwkekhqvrisvtredglklnmp
pp

SCOPe Domain Coordinates for d4g23a3:

Click to download the PDB-style file with coordinates for d4g23a3.
(The format of our PDB-style files is described here.)

Timeline for d4g23a3:

  • d4g23a3 is new in SCOPe 2.08-stable