Lineage for d1czdb1 (1czd B:2001-2110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977008Protein gp45 sliding clamp [55984] (2 species)
  7. 2977022Species Bacteriophage T4 [TaxId:10665] [55986] (1 PDB entry)
  8. 2977025Domain d1czdb1: 1czd B:2001-2110 [41376]

Details for d1czdb1

PDB Entry: 1czd (more details), 2.45 Å

PDB Description: crystal structure of the processivity clamp gp45 from bacteriophage t4
PDB Compounds: (B:) DNA polymerase accessory protein g45

SCOPe Domain Sequences for d1czdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czdb1 d.131.1.2 (B:2001-2110) gp45 sliding clamp {Bacteriophage T4 [TaxId: 10665]}
mklskdttallknfatinsgimlksgqfimtravngttyaeanisdvidfdvaiydlngf
lgilslvnddaeisqsedgnikiadarstifwpaadpstvvapnkpipfp

SCOPe Domain Coordinates for d1czdb1:

Click to download the PDB-style file with coordinates for d1czdb1.
(The format of our PDB-style files is described here.)

Timeline for d1czdb1: