Lineage for d1czda2 (1czd A:1111-1228)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84022Fold d.131: DNA clamp [55978] (1 superfamily)
  4. 84023Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 84036Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
  6. 84037Protein gp45 sliding clamp [55984] (2 species)
  7. 84051Species Bacteriophage T4 [TaxId:10665] [55986] (1 PDB entry)
  8. 84053Domain d1czda2: 1czd A:1111-1228 [41375]

Details for d1czda2

PDB Entry: 1czd (more details), 2.45 Å

PDB Description: crystal structure of the processivity clamp gp45 from bacteriophage t4

SCOP Domain Sequences for d1czda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czda2 d.131.1.2 (A:1111-1228) gp45 sliding clamp {Bacteriophage T4}
vasavteikaedlqqllrvsrglqidtiaitvkegkivingfnkvedsaltrvkysltlg
dydgentfnfiinmanmkmqpgnyklllwakgkqgaakfegehanyvvaleadsthdf

SCOP Domain Coordinates for d1czda2:

Click to download the PDB-style file with coordinates for d1czda2.
(The format of our PDB-style files is described here.)

Timeline for d1czda2: