SCOPe 2.08: Domain d1czda1: 1czd A:1001-1110

Lineage for d1czda1 (1czd A:1001-1110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein gp45 sliding clamp [55984] (2 species)

7. Species Bacteriophage T4 [TaxId:10665] [55986] (1 PDB entry)

8. Domain d1czda1: 1czd A:1001-1110 [41374]

Details for d1czda1

PDB Entry: 1czd, 2.45 Å

PDB Description: crystal structure of the processivity clamp gp45 from bacteriophage t4

PDB Compounds: (A:) DNA polymerase accessory protein g45

SCOPe Domain Sequences for d1czda1:

Sequence; same for both SEQRES and ATOM records:

>d1czda1 d.131.1.2 (A:1001-1110) gp45 sliding clamp {Bacteriophage T4 [TaxId: 10665]}
mklskdttallknfatinsgimlksgqfimtravngttyaeanisdvidfdvaiydlngf
lgilslvnddaeisqsedgnikiadarstifwpaadpstvvapnkpipfp

Timeline for d1czda1:

• d1czda1 first appeared (with stable ids) in SCOP 1.55
  
• d1czda1 appears in SCOPe 2.07