Lineage for d4d2nc1 (4d2n C:237-339)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751926Domain d4d2nc1: 4d2n C:237-339 [413739]
    automated match to d1hzhh3
    complexed with gol

Details for d4d2nc1

PDB Entry: 4d2n (more details), 2.7 Å

PDB Description: crystal structure of deglycosylated serum-derived human igg4 fc
PDB Compounds: (C:) ig gamma-4 chain c region

SCOPe Domain Sequences for d4d2nc1:

Sequence, based on SEQRES records: (download)

>d4d2nc1 b.1.1.2 (C:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvsqedpevqfnwyvdgvevhnaktkpreeqf
dstyrvvsvltvlhqdwlngkeykckvsnkglpssiektiska

Sequence, based on observed residues (ATOM records): (download)

>d4d2nc1 b.1.1.2 (C:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvsqedpevqfnwyvdgvevhnaktkpreeqf
dstyrvvsvltvlhqdwlngkeykckvsnlpssiektiska

SCOPe Domain Coordinates for d4d2nc1:

Click to download the PDB-style file with coordinates for d4d2nc1.
(The format of our PDB-style files is described here.)

Timeline for d4d2nc1:

  • d4d2nc1 is new in SCOPe 2.08-stable